| request information: |
|
| Catalog Code: | H00054431-A01 |
| Product Name: | DNAJC10 Antibody |
| Product Description: | Mouse Polyclonal anti-DNAJC10 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 54431 |
| Gene Symbol: | DNAJC10 |
| Omim ID: | 607987, |
| Immunogen: | DNAJC10 (NP_061854, 688 a.a. ~ 794 a.a) partial recombinant protein with GST tag. |
| Epitope: | KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTR
DAKAIAALISEKLETLRNQGKRNKDEL* |
| Specificity: | DNAJC10 - DnaJ (Hsp40) homolog, subfamily C, member 10 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp434J1813 antibody, anti-ERdj5 antibody, anti-JPDI antibody, anti-MGC104194 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Product References: | 1. Corazzari M, Piacentini M et al.. Targeting homeostatic mechanisms of endoplasmic reticulum stress to increase susceptibility of cancer cells to fenretinide-induced apoptosis: the role of stress proteins ERdj5 and ERp57. Br J Cancer. 2007 Apr 10;96(7):1062-71. Epub 2007 Mar 13. 2. Ushioda R, Hoseki J, Araki K, et al. ERdj5 is required as a disulfide reductase for degradation of misfolded proteins in the ER. Science. 2008 Jul 25;321(5888):569-72. |
order or
more information: | company product webpage |