| request information: |
|
| Catalog Code: | H00054413-M02 |
| Product Name: | NLGN3 Antibody |
| Product Description: | Mouse Monoclonal anti-NLGN3 (2A6) |
| Clone: | 2A6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 54413 |
| Gene Symbol: | NLGN3 |
| Omim ID: | 300336, 300425, 300494, |
| Immunogen: | NLGN3 (NP_061850, 590 a.a. ~ 690 a.a) partial recombinant protein with GST tag. |
| Epitope: | PRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAQGSWN
GDQDAGPLLVENPRDYSTELS* |
| Specificity: | NLGN3 - neuroligin 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. Mutations in this gene may be associated with autism and Asperger syndrome. Multiple transcript variants encoding distinct isoforms have been identified for this gene, but their full length sequences have not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-ASPGX1 antibody, anti-AUTSX1 antibody, anti-HNL3 antibody, anti-KIAA1480 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |