| request information: |
|
| Catalog Code: | H00054332-A01 |
| Product Name: | GDAP1 Antibody |
| Product Description: | Mouse Polyclonal anti-GDAP1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 54332 |
| Gene Symbol: | GDAP1 |
| Omim ID: | 214400, 606598, 607706, 607831, |
| Immunogen: | GDAP1 (NP_061845, 158 a.a. ~ 258 a.a) partial recombinant protein with GST tag. |
| Epitope: | TRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQ
PWLCGESFTLADVSLAVTLHR* |
| Specificity: | GDAP1 - ganglioside-induced differentiation-associated protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CMT2G antibody, anti-CMT2K antibody, anti-CMT4A antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |