| request information: |
|
| Catalog Code: | H00054108-M05 |
| Product Name: | CHRAC1 Antibody |
| Product Description: | Mouse Monoclonal anti-CHRAC1 (4B8) |
| Clone: | 4B8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 54108 |
| Gene Symbol: | CHRAC1 |
| Omim ID: | 607268, |
| Immunogen: | CHRAC1 (AAH15891, 1 a.a. ~ 132 a.a) full length recombinant protein with GST tag. |
| Epitope: | MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLAN
TAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS* |
| Specificity: | CHRAC1 - chromatin accessibility complex 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CHARC1 antibody, anti-CHARC15 antibody, anti-CHRAC15 antibody, anti-YCL1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |