| CatalogCode: | H00054108-B01 |
| ProductName: | CHRAC1 Antibody |
| Product Description: | Mouse Polyclonal anti-CHRAC1 - chromatin accessibility complex 1, MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | CHRAC1 (-, 1 a.a. ~ 131 a.a) full-length human protein. |
| Epitope: | MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS ... |
| CrossReactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Background: | CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CHARC1 antibody, anti-CHARC15 antibody, anti-CHRAC15 antibody, anti-YCL1 antibody |
| ProteinTarget: | chromatin accessibility complex 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 54108 |
| Gene_Symbol: | CHRAC1 |
order or
more information: | company product webpage |
| request information: |
|