| CatalogCode: | H00054108-A01 |
| ProductName: | CHRAC1 Antibody |
| Product Description: | Mouse Polyclonal anti-CHRAC1 |
| Clonality: | Polyclonal |
| Immunogen: | CHRAC1 (AAH15891, 1 a.a. ~ 132 a.a) full length recombinant protein with GST tag. |
| Epitope: | MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS* ... |
| Specificity: | CHRAC1 - chromatin accessibility complex 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CHARC1 antibody, anti-CHARC15 antibody, anti-CHRAC15 antibody, anti-YCL1 antibody |
| ProteinTarget: | CHRAC1 - chromatin accessibility complex 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 54108 |
| Gene_Symbol: | CHRAC1 |
| Omim_ID: | 607268 H00054108-M05 |