| request information: |
|
| Catalog Code: | H00053831-M02 |
| Product Name: | GPR84 Antibody |
| Product Description: | Mouse Monoclonal anti-GPR84 (5B7) |
| Clone: | 5B7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 53831 |
| Gene Symbol: | GPR84 |
| Omim ID: | 606383, |
| Immunogen: | GPR84 (NP_065103, 208 a.a. ~ 317 a.a) partial recombinant protein with GST tag. |
| Epitope: | AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQM
AEKSPPEASAKAQPIKGARRAPDSSSEFGK* |
| Specificity: | GPR84 - G protein-coupled receptor 84 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Ascites |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-EX33 antibody, anti-GPCR4 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |