| request information: |
|
| Catalog Code: | H00051776-M05 |
| Product Name: | ZAK Antibody |
| Product Description: | Mouse Monoclonal anti-ZAK (3B6) |
| Clone: | 3B6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51776 |
| Gene Symbol: | ZAK |
| Omim ID: | 609479, |
| Immunogen: | ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYG
IVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY |
| Specificity: | ZAK - sterile alpha motif and leucine zipper containing kinase AZK |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AZK antibody, anti-MLK7 antibody, anti-MLT antibody, anti-MLTK antibody, anti-MRK antibody, anti-mlklak antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |