ExactAntigen

Mouse Monoclonal anti-ZAK (3D11)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00051776-M02
ProductName:ZAK Antibody
Product Description:Mouse Monoclonal anti-ZAK (3D11)
Clone:3D11
Clonality:Monoclonal
Immunogen:ZAK (AAH01401, 1 a.a. ~ 456 a.a) full length recombinant protein with GST tag.
Epitope:MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQ ...
Specificity:ZAK - sterile alpha motif and leucine zipper containing kinase AZK
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-AZK antibody, anti-MLK7 antibody, anti-MLT antibody, anti-MLTK antibody, anti-MRK antibody, anti-mlklak antibody
ProteinTarget:ZAK - sterile alpha motif and leucine zipper containing kinase AZK
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:51776
Gene_Symbol:ZAK
Omim_ID:609479,
see all human ZAK antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about