ExactAntigen

HBXAP Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00051773-M05
Product Type:Primary Antibody
Product Name:HBXAP Antibody
List Price:275
Clonality:Monoclonal
Gene ID:51773
Host:Mouse
Clone:3E6
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-HBXAP (3E6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = HBXAP PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-RSF-1 antibody, anti-RSF1 antibody, anti-XAP8 antibody, anti-p325 antibody
Immunogen:HBXAP (NP_057662, 1343 a.a. ~ 1442 a.a) partial recombinant protein with GST tag.
Epitope:IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL* ...
Specificity:HBXAP - hepatitis B virus x associated protein
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:HBXAP
Omim ID:608522,
see all human HBXAP antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about