| request information: |
|
| Catalog Code: | H00051755-M02 |
| Product Name: | CRKRS Antibody |
| Product Description: | Mouse Monoclonal anti-CRKRS (2F6) |
| Clone: | 2F6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51755 |
| Gene Symbol: | CRKRS |
| Immunogen: | CRKRS (NP_057591, 1281 a.a. ~ 1380 a.a) partial recombinant protein with GST tag. |
| Epitope: | LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSG
PALTESLVQTLVKNRTFSGSL |
| Specificity: | CRKRS - Cdc2-related kinase, arginine/serine-rich |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CRK7 antibody, anti-CRKR antibody, anti-KIAA0904 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |