| request information: |
|
| Catalog Code: | H00051747-A01 |
| Product Name: | CROP Antibody |
| Product Description: | Mouse Polyclonal anti-CROP |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51747 |
| Gene Symbol: | CROP |
| Omim ID: | 609434 |
| Immunogen: | CROP (NP_006098, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV
GYERDFLRYLQSLLAEVERRIRRGHARLALS* |
| Specificity: | CROP - cisplatin resistance-associated overexpressed protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a cisplatin resistance-associated overexpressed protein (CROP). The N-terminal half of the CROP contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-LUC7A antibody, anti-OA48-18 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |