| CatalogCode: | | H00051738-M13 |
| ProductName: | | GHRL Antibody |
| Product Description: | | Mouse Monoclonal anti-GHRL (3G3) |
| Clone: | | 3G3 |
| Clonality: | | Monoclonal |
| Immunogen: | | GHRL (NP_057446, 24 a.a. ~ 118 a.a) partial recombinant protein with GST tag. |
| Epitope: | | GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK* ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody reactive against recombinant protein on ELISA. |
| Background: | | Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor (GHSR; MIM 601898) and is involved in regulating growth hormone (GH; MIM 139250) release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 (MIM 602886) and is involved in satiety and decreased food intake.[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG Mix Kappa |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-MTLRP antibody, anti-ghrelin antibody |
| ProteinTarget: | | ghrelin, growth hormone secretagogue receptor ligand |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 51738 |
| Gene_Symbol: | | GHRL |
| Omim_ID: | | 601665, 605353, |
| more information: | | company product webpage |