| request information: | |
| Catalog Code: | H00051738-M07 |
| Product Name: | ghrelin Antibody |
| Product Description: | Mouse Monoclonal anti-ghrelin (1C8) |
| Clone: | 1C8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51738 |
| Gene Symbol: | GHRL |
| Omim ID: | 601665, 605353, |
| Immunogen: | GHRL (AAH25791, 1 a.a. ~ 118 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAP FDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK* |
| Specificity: | ghrelin, growth hormone secretagogue receptor ligand |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor (GHSR; MIM 601898) and is involved in regulating growth hormone (GH; MIM 139250) release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 (MIM 602886) and is involved in satiety and decreased food intake.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Ghrl antibody, anti-Growth hormone secretagogue antibody, anti-Growth-hormone releasing protein antibody, anti-Motilin-related peptide antibody, anti-M46 protein antibody, anti-Mtlrp antibody, anti-MTLRPAP antibody, anti-Appetite-regulating hormone antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |