| Catalog Code: | H00051738-M06 |
| Product Type: | Primary Antibody |
| Product Name: | ghrelin, growth hormone secretagogue receptor ligand Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 51738 |
| Host: | Mouse |
| Clone: | 4E5 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-ghrelin, growth hormone secretagogue receptor ligand (4E5) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Genbank acession number is BC025791. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-MTLRP antibody, anti-ghrelin antibody |
| Immunogen: | GHRL (AAH25791, 1 a.a. ~ 118 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK* ... |
| Specificity: | ghrelin, growth hormone secretagogue receptor ligand |
| Purity: | IgG purified |
| Buffer: | 1X PBS pH 7.2 |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug). |
| Gene Symbol: | GHRL |
| Omim ID: | 601665, 605353, |