ExactAntigen

Mouse Monoclonal anti-GHRL (2E2)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00051738-M05
ProductName:GHRL Antibody
Product Description:Mouse Monoclonal anti-GHRL (2E2)
Clone:2E2
Clonality:Monoclonal
Immunogen:GHRL (AAH25791, 1 a.a. ~ 118 a.a) full length recombinant protein with GST tag.
Epitope:MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor (GHSR; MIM 601898) and is involved in regulating growth hormone (GH; MIM 139250) release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 (MIM 602886) and is involved in satiety and decreased food intake.[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-MTLRP antibody, anti-ghrelin antibody
ProteinTarget:ghrelin, growth hormone secretagogue receptor ligand
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:51738
Gene_Symbol:GHRL
Omim_ID:601665, 605353,
see all human ghrelin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about