| request information: |
|
| Catalog Code: | H00051738-A02 |
| Product Name: | GHRL Antibody |
| Product Description: | Mouse Polyclonal anti-GHRL |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51738 |
| Gene Symbol: | GHRL |
| Omim ID: | 601665 605353 |
| Immunogen: | GHRL (NP_057446, 24 a.a. ~ 118 a.a) partial recombinant protein with GST tag. |
| Epitope: | GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFL
QDILWEEAKEAPADK* |
| Specificity: | GHRL - ghrelin precursor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor (GHSR; MIM 601898) and is involved in regulating growth hormone (GH; MIM 139250) release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 (MIM 602886) and is involved in satiety and decreased food intake.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MTLRP antibody, anti-ghrelin antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |