ExactAntigen

Mouse Polyclonal anti-GHRL | Novus Biologicals antibody product information
CatalogCode:H00051738-A01
ProductName:GHRL Antibody
Product Description:Mouse Polyclonal anti-GHRL
Clonality:Polyclonal
Immunogen:GHRL (AAH25791, 1 a.a. ~ 118 a.a) full length recombinant protein with GST tag.
Epitope:MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK* ...
Specificity:GHRL - ghrelin, growth hormone secretagogue receptor ligand
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor (GHSR; MIM 601898) and is involved in regulating growth hormone (GH; MIM 139250) release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 (MIM 602886) and is involved in satiety and decreased food intake.[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-MTLRP antibody, anti-ghrelin antibody
ProteinTarget:GHRL - ghrelin, growth hormone secretagogue receptor ligand
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:51738
Gene_Symbol:GHRL
Omim_ID:601665, 605353,
order or
more information
:
company product webpage
request information:
Also see:
all human ghrelin antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about