| request information: |
|
| Catalog Code: | H00051734-A01 |
| Product Name: | SEPX1 Antibody |
| Product Description: | Mouse Polyclonal anti-SEPX1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51734 |
| Gene Symbol: | SEPX1 |
| Omim ID: | 606216, |
| Immunogen: | SEPX1 (NP_057416, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLG
HEFLN* |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant SEPX1. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HSPC270 antibody, anti-MGC3344 antibody, anti-SELR antibody, anti-SELX antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |