ExactAntigen

POLR3K Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00051728-M01
Product Type:Primary Antibody
Product Name:POLR3K Antibody
List Price:275
Clonality:Monoclonal
Gene ID:51728
Host:Mouse
Clone:3F5
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-POLR3K (3F5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = POLR3K PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-C11 antibody, anti-C11-RNP3 antibody, anti-RPC10 antibody, anti-RPC11 antibody, anti-hRPC11 antibody
Immunogen:POLR3K (AAH11932, 1 a.a. ~ 109 a.a) full length recombinant protein with GST tag.
Epitope:MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD* ...
Specificity:POLR3K - polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:POLR3K
Omim ID:606007,
see all human POLR3K antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about