| CatalogCode: | | H00051728-B01 |
| ProductName: | | POLR3K Antibody |
| Product Description: | | Mouse Polyclonal anti-POLR3K |
| Clonality: | | Polyclonal |
| Immunogen: | | POLR3K (AAH11932, 1 a.a. ~ 109 a.a) full-length human protein. |
| Epitope: | | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD* ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on transfected lysate.Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera |
| Background: | | This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-C11 antibody, anti-C11-RNP3 antibody, anti-RPC10 antibody, anti-RPC11 antibody, anti-hRPC11 antibody |
| ProteinTarget: | | POLR3K |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 51728 |
| Gene_Symbol: | | POLR3K |
| Omim_ID: | | 606007, |
| more information: | | company product webpage |