ExactAntigen

Mouse Polyclonal anti-POLR3K | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00051728-B01
ProductName: POLR3K Antibody
Product Description: Mouse Polyclonal anti-POLR3K
Clonality: Polyclonal
Immunogen: POLR3K (AAH11932, 1 a.a. ~ 109 a.a) full-length human protein.
Epitope: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: The quality control of this antibody is limited to Western blot on transfected lysate.Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Background: This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-C11 antibody, anti-C11-RNP3 antibody, anti-RPC10 antibody, anti-RPC11 antibody, anti-hRPC11 antibody
ProteinTarget: POLR3K
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 51728
Gene_Symbol: POLR3K
Omim_ID: 606007,
more information: company product webpage
Also see:
see all human POLR3K antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about