| request information: |
|
| Catalog Code: | H00051728-A01 |
| Product Name: | POLR3K Antibody |
| Product Description: | Mouse Polyclonal anti-POLR3K |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51728 |
| Gene Symbol: | POLR3K |
| Omim ID: | 606007 |
| Immunogen: | POLR3K (AAH11932, 1 a.a. ~ 109 a.a) full length recombinant protein with GST tag. |
| Epitope: | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYF
MQLQTRSADEPMTTFYKCCNAQCGHRWRD* |
| Specificity: | POLR3K - polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-C11 antibody, anti-C11-RNP3 antibody, anti-RPC10 antibody, anti-RPC11 antibody, anti-hRPC11 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |