ExactAntigen

ACSL5 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00051703-M01
Product Type:Primary Antibody
Product Name:ACSL5 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:51703
Host:Mouse
Clone:5H8
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-ACSL5 (5H8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty
Alternate Names:anti-ACSL5 antibody, anti-acyl-CoA synthetase long-chain family member 5 antibody, anti-HGNC:16526 antibody, anti-ACS2 antibody, anti-ACS5 antibody, anti-FACL5 antib antibody
Immunogen:ACSL5 (NP_057318, 91 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
Epitope:PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS* ...
Specificity:ACSL5 - acyl-CoA synthetase long-chain family member 5
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ACSL5
Omim ID:605677,
see all human ACSL5 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about