| Catalog Code: | H00051703-M01 |
| Product Type: | Primary Antibody |
| Product Name: | ACSL5 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 51703 |
| Host: | Mouse |
| Clone: | 5H8 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-ACSL5 (5H8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty |
| Alternate Names: | anti-ACSL5 antibody, anti-acyl-CoA synthetase long-chain family member 5 antibody, anti-HGNC:16526 antibody, anti-ACS2 antibody, anti-ACS5 antibody, anti-FACL5 antib antibody |
| Immunogen: | ACSL5 (NP_057318, 91 a.a. ~ 187 a.a) partial recombinant protein with GST tag. |
| Epitope: | PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS* ... |
| Specificity: | ACSL5 - acyl-CoA synthetase long-chain family member 5 |
| Purity: | IgG purified |
| Packaging: | 0.1 ml IgG purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | ACSL5 |
| Omim ID: | 605677, |