| request information: |
|
| Catalog Code: | H00051703-A01 |
| Product Name: | ACSL5 Antibody |
| Product Description: | Mouse Polyclonal anti-ACSL5 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51703 |
| Gene Symbol: | ACSL5 |
| Omim ID: | 605677 |
| Immunogen: | ACSL5 (NP_057318, 91 a.a. ~ 187 a.a) partial recombinant protein with GST tag. |
| Epitope: | PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSD
RAEYLGSCLLHKGYKSS* |
| Specificity: | ACSL5 - acyl-CoA synthetase long-chain family member 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ACSL5 antibody, anti-acyl-CoA synthetase long-chain family member 5 antibody, anti-HGNC:16526 antibody, anti-ACS2 antibody, anti-ACS5 antibody, anti-FACL5 antib antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |