| request information: |
|
| Catalog Code: | H00051701-M01 |
| Product Name: | NLK Antibody |
| Product Description: | Mouse Monoclonal anti-NLK (1C1) |
| Clone: | 1C1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51701 |
| Gene Symbol: | NLK |
| Immunogen: | NLK (AAH64663, 416 a.a. ~ 515 a.a) full length recombinant protein with GST tag. |
| Epitope: | DEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFK
SFISSTVAQPSEMPPSPLVWE |
| Specificity: | NLK - nemo like kinase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |