| request information: | |
| Catalog Code: | H00051592-M01 |
| Product Name: | TRIM33 Antibody |
| Product Description: | Mouse Monoclonal anti-TRIM33 (6D1) |
| Clone: | 6D1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51592 |
| Gene Symbol: | TRIM33 |
| Omim ID: | 188550, 605769, |
| Immunogen: | TRIM33 (NP_056990, 1006 a.a. ~ 1106 a.a) partial recombinant protein with GST tag. |
| Epitope: | VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQV YADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPL PEFEQEEDDGEVTEDS* |
| Specificity: | TRIM33 - tripartite motif-containing 33 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Nuclear |
| Background: | The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TIF1 gamma antibody, anti-Ectodermin antibody, anti-PTC7 antibody, anti-Ret fused gene 7 antibody, anti-Rfg7 protein antibody, anti-Transcriptional intermediary factor 1 gamma antibody, anti-Trim33 antibody, anti-Tripartite motif containing 33 antibody, anti-Tripartite motif containing 33 protein antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |