ExactAntigen

TRIM33 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00051592-M01
Product Name:TRIM33 Antibody
Product Description:Mouse Monoclonal anti-TRIM33 (6D1)
Clone:6D1
Clonality:Monoclonal
ListPrice:295
Gene ID:51592
Gene Symbol:TRIM33
Omim ID:188550, 605769,
Immunogen:TRIM33 (NP_056990, 1006 a.a. ~ 1106 a.a) partial recombinant protein with GST tag.
Epitope:VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQV YADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPL PEFEQEEDDGEVTEDS*
Specificity:TRIM33 - tripartite motif-containing 33
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Localization:Nuclear
Background:The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host Name:Mouse
Buffer:Phosphate buffered saline, pH 7.2
Application Summary:ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot
Species Summary:Hu
Alternate Names:anti-TIF1 gamma antibody, anti-Ectodermin antibody, anti-PTC7 antibody, anti-Ret fused gene 7 antibody, anti-Rfg7 protein antibody, anti-Transcriptional intermediary factor 1 gamma antibody, anti-Trim33 antibody, anti-Tripartite motif containing 33 antibody, anti-Tripartite motif containing 33 protein antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human TRIM33 antibodies


2008©ExactAntigen home | browse | about