| request information: |
|
| Catalog Code: | H00051592-A01 |
| Product Name: | TRIM33 Antibody |
| Product Description: | Mouse Polyclonal anti-TRIM33 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51592 |
| Gene Symbol: | TRIM33 |
| Omim ID: | 188550, 605769, |
| Immunogen: | TRIM33 (NP_056990, 1006 a.a. ~ 1106 a.a) partial recombinant protein with GST tag. |
| Epitope: | VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDR
TFAPLPEFEQEEDDGEVTEDS* |
| Specificity: | TRIM33 - tripartite motif-containing 33 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PTC7 antibody, anti-RFG7 antibody, anti-TF1G antibody, anti-TIF1G antibody, anti-TIF1GAMMA antibody, anti-TIFGAMMA antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |