| request information: |
|
| Catalog Code: | H00051586-M02 |
| Product Name: | ARC105 Antibody |
| Product Description: | Mouse Monoclonal anti-ARC105 (4A4) |
| Clone: | 4A4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51586 |
| Gene Symbol: | PCQAP |
| Omim ID: | 607372, |
| Immunogen: | PCQAP (NP_056973, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. |
| Epitope: | MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVS
DPMNALQSL* |
| Specificity: | PCQAP - PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ARC105 antibody, anti-CAG7A antibody, anti-CTG7A antibody, anti-DKFZp686A2214 antibody, anti-DKFZp762B1216 antibody, anti-MED15 antibody, anti-TIG-1 antibody, anti-TIG1 antibody, anti-TNRC7 antibody, anti-PCQAP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | 1. Varelas X, Sakuma R, Samavarchi-Tehrani P, et al. TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal. Nat Cell Biol. 2008 Jun 22. |
order or
more information: | company product webpage |