| CatalogCode: | H00051582-M01 |
| ProductName: | AZIN1 Antibody |
| Product Description: | Mouse Monoclonal anti-AZIN1 (8B9) |
| Clone: | 8B9 |
| Clonality: | Monoclonal |
| Immunogen: | AZIN1 (NP_056962, 339 a.a. ~ 448 a.a) partial recombinant protein with GST tag. |
| Epitope: | HKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGITSDSMMKNFFFVPSCIQLSQEDSFSAE* ... |
| Specificity: | AZIN1 - antizyme inhibitor 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Ornithine decarboxylase (ODC) catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis. Ornithine decarboxylase antizymes play a role in the regulation of polyamine synthesis by binding to and inhibiting ornithine decarboxylase. The protein encoded by this gene is highly similar to ODC. It binds to ODC antizyme and stabilizes ODC, thus inhibiting antizyme-mediated ODC degradation. Two alternatively spliced transcript variants have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MGC3832 antibody, anti-MGC691 antibody, anti-OAZI antibody, anti-OAZIN antibody, anti-ODC1L antibody |
| ProteinTarget: | AZIN1 - antizyme inhibitor 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 51582 |
| Gene_Symbol: | AZIN1 |
| Omim_ID: | 607909, |
order or
more information: | company product webpage |
| request information: |
|