ExactAntigen

CINP Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00051550-A01
Product Name:CINP Antibody
Product Description:Mouse Polyclonal anti-CINP
Clonality:Polyclonal
ListPrice:225
Gene ID:51550
Gene Symbol:CINP
Immunogen:CINP (NP_116019, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Epitope:MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEK
VCLEYNEELEKLCEELQATLDGLTKIQVKME*
Specificity:CINP - cyclin-dependent kinase 2-interacting protein
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Background:The function of this gene has not been reported. This gene contains a trinucleotide (ctt) repeat length polymorphism; alleles with either one or two repeat units have been identified.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-MGC849 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human CINP antibodies


2008©ExactAntigen home | browse | about