| request information: |
|
| Catalog Code: | H00051477-A01 |
| Product Name: | ISYNA1 Antibody |
| Product Description: | Mouse Polyclonal anti-ISYNA1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51477 |
| Gene Symbol: | ISYNA1 |
| Immunogen: | ISYNA1 (NP_057452, 331 a.a. ~ 431 a.a) partial recombinant protein with GST tag. |
| Epitope: | SYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTN
TLVLHNTCEDSLLAAPIMLDL* |
| Specificity: | ISYNA1 - myo-inositol 1-phosphate synthase A1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate (Seelan et al., 2004 [PubMed 15464731]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |