| request information: |
|
| Catalog Code: | H00051463-M01 |
| Product Name: | GPR89 Antibody |
| Product Description: | Mouse Monoclonal anti-GPR89 (4D8) |
| Clone: | 4D8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51463 |
| Gene Symbol: | GPR89 |
| Immunogen: | GPR89 (AAH03187, 175 a.a. ~ 285 a.a) partial recombinant protein with GST tag. |
| Epitope: | SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDA
LEELSRQLFLETADLYATKERIEYSKTFKGK* |
| Specificity: | GPR89 - G protein-coupled receptor 89 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-AL844549.1 antibody, anti-SH120 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |