| request information: |
|
| Catalog Code: | H00051460-B01 |
| Product Name: | SFMBT1 Antibody |
| Product Description: | Mouse Polyclonal anti-SFMBT1 - Scm-like with four mbt domains 1, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 51460 |
| Gene Symbol: | SFMBT1 |
| Immunogen: | SFMBT1 (1 a.a. ~ 866 a.a) full-length human protein. |
| Epitope: | MNGEQQLDADAGSGMEEVELSWEDYLEETGSTAVPYGSFKHVDTRLQNGFAPGMKLEVAVRTDPETYWVATVITTCEQL
LLLRYDGYGEDRRADFWCDIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNP
LDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRH
LKNEAEWQEILAKVKEEE |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. It encodes a protein which contains four malignant brain tumor repeat (mbt) domains and may be involved in antigen recognition. Several alternative splice variants have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp434L243 antibody, anti-RU1 antibody, anti-SFMBT antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |