| request information: |
|
| Catalog Code: | H00051460-A01 |
| Product Name: | SFMBT1 Antibody |
| Product Description: | Mouse Polyclonal anti-SFMBT1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51460 |
| Gene Symbol: | SFMBT1 |
| Omim ID: | 607319, |
| Immunogen: | SFMBT1 (NP_057413, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. |
| Epitope: | EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGL
ESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ |
| Specificity: | SFMBT1 - Scm-like with four mbt domains 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. It encodes a protein which contains four malignant brain tumor repeat (mbt) domains and may be involved in antigen recognition. Several alternative splice variants have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp434L243 antibody, anti-RU1 antibody, anti-SFMBT antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |