| request information: |
|
| Catalog Code: | H00051455-A01 |
| Product Name: | REV1L Antibody |
| Product Description: | Mouse Polyclonal anti-REV1L |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51455 |
| Gene Symbol: | REV1L |
| Omim ID: | 606134, |
| Immunogen: | REV1L (NP_057400, 1097 a.a. ~ 1195 a.a) partial recombinant protein with GST tag. |
| Epitope: | SPAKTLPGACGSPQKLIDGFLKHEGPPAEKPLEELSASTSGVPGLSSLQSDPAGCVRPPAPNLAGAVEFNDVKTLLREW
ITTISDPMEEDILQVVKYC* |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant REV1L. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | This gene encodes a protein with similarity to the S. cerevisiae mutagenesis protein Rev1. The Rev1 proteins contain a BRCT domain, which is important in protein-protein interactions. A suggested role for the human Rev1-like protein is as a scaffold that recruits DNA polymerases involved in translesion synthesis (TLS) of damaged DNA. Two alternatively spliced transcript variants that encode different proteins have been found. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC26225 antibody, anti-REV1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |