| request information: |
|
| Catalog Code: | H00051450-A01 |
| Product Name: | PRRX2 Antibody |
| Product Description: | Mouse Polyclonal anti-PRRX2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51450 |
| Gene Symbol: | PRRX2 |
| Omim ID: | 604675 |
| Immunogen: | PRRX2 (NP_057391, 110 a.a. ~ 203 a.a) partial recombinant protein with GST tag. |
| Epitope: | TFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPV
APRPTALSPDYLSW* |
| Specificity: | PRRX2 - paired related homeobox 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC19843 antibody, anti-PMX2 antibody, anti-PRX2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |