| request information: |
|
| Catalog Code: | H00051378-A01 |
| Product Name: | angiopoietin 4 Antibody |
| Product Description: | Mouse Polyclonal anti-angiopoietin 4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51378 |
| Gene Symbol: | ANGPT4 |
| Omim ID: | 603705, |
| Immunogen: | ANGPT4 (NP_057069, 25 a.a. ~ 112 a.a) partial recombinant protein with GST tag. |
| Epitope: | TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKK
LERAIKTI* |
| Specificity: | angiopoietin 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis is thought to involve regulation of endothelial cell interactions with supporting perivascular cells. The protein encoded by this gene functions as an agonist and is an angiopoietin. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AGP4 antibody, anti-ANG-3 antibody, anti-ANG4 antibody, anti-MGC138181 antibody, anti-MGC138183 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |