| CatalogCode: | H00051365-A01 |
| ProductName: | phospholipase A1 member A Antibody |
| Product Description: | Mouse Polyclonal anti-phospholipase A1 member A |
| Clonality: | Polyclonal |
| Immunogen: | PLA1A (NP_056984, 241 a.a. ~ 341 a.a) partial recombinant protein with GST tag. |
| Epitope: | DQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHH* ... |
| Specificity: | phospholipase A1 member A |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-PS-PLA1 antibody, anti-PSPLA1 antibody |
| ProteinTarget: | phospholipase A1 member A |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 51365 |
| Gene_Symbol: | PLA1A |
| Omim_ID: | 607460, |
order or
more information: | company product webpage |
| request information: |
|