| request information: |
|
| Catalog Code: | H00051329-M09 |
| Product Name: | ARL6IP4 Antibody |
| Product Description: | Mouse Monoclonal anti-ARL6IP4 (5E5) |
| Clone: | 5E5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51329 |
| Gene Symbol: | ARL6IP4 |
| Omim ID: | 607668, |
| Immunogen: | ARL6IP4 (NP_061164, 261 a.a. ~ 361 a.a) partial recombinant protein with GST tag. |
| Epitope: | PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDA RQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQA TRGDCLAFQMRAGLLP* |
| Specificity: | ARL6IP4 - ADP-ribosylation-like factor 6 interacting protein 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | ARL6IP4 interacts with ADP-ribosylation-like factor 6. ADP-ribosylation factors function as regulators of vesicular traffic and actin remodelling. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-MGC814 antibody, anti-SR-25 antibody, anti-SRp25 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |