| request information: |
|
| Catalog Code: | H00051324-M01 |
| Product Name: | SPG21 Antibody |
| Product Description: | Mouse Monoclonal anti-SPG21 (2B11) |
| Clone: | 2B11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51324 |
| Gene Symbol: | SPG21 |
| Omim ID: | 248900, 608181, |
| Immunogen: | SPG21 (NP_057714, 211 a.a. ~ 307 a.a) partial recombinant protein with GST tag. |
| Epitope: | PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMV
SAEELEVQKGSLGISQE* |
| Specificity: | SPG21 - spastic paraplegia 21 (autosomal recessive, Mast syndrome) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ACP33 antibody, anti-BM-019 antibody, anti-GL010 antibody, anti-MAST antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |