| request information: |
|
| Catalog Code: | H00051295-M01 |
| Product Name: | SITPEC Antibody |
| Product Description: | Mouse Monoclonal anti-SITPEC (1B8) |
| Clone: | 1B8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51295 |
| Gene Symbol: | SITPEC |
| Omim ID: | 608388, |
| Immunogen: | SITPEC (AAH00193, 20 a.a. ~ 432 a.a) full length recombinant protein with GST tag. |
| Epitope: | TCGAALTGTSISQVPRRLPRGLHCSAAAHSSEQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAE
HSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNK
ETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGA
ADPPQPHIVGIQSPDQQA |
| Specificity: | SITPEC - signaling intermediate in Toll pathway, evolutionarily conserved |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu , |
| Alternate Names: | anti-ECSIT antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |