| request information: | |
| Catalog Code: | H00051284-M07 |
| Product Name: | TLR7 Antibody |
| Product Description: | Mouse Monoclonal anti-TLR7 (4G6) |
| Clone: | 4G6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51284 |
| Gene Symbol: | TLR7 |
| Omim ID: | 300365, |
| Immunogen: | TLR7 (NP_057646, 27 a.a. ~ 127 a.a) partial recombinant protein with GST tag. |
| Epitope: | ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPL GSKNNMCIKRLQIKPRSFSGL* |
| Specificity: | TLR7 - toll-like receptor 7 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung, placenta, and spleen, and lies in close proximity to another family member, TLR8, on chromosome X. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |