| CatalogCode: | H00051280-M06 |
| ProductName: | GOLPH2 Antibody |
| Product Description: | Mouse Monoclonal anti-GOLPH2 (5B10) |
| Clone: | 5B10 |
| Clonality: | Monoclonal |
| Immunogen: | GOLPH2 (NP_057632, 302 a.a. ~ 402 a.a) partial recombinant protein with GST tag. |
| Epitope: | VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL* ... |
| Specificity: | GOLPH2 - golgi phosphoprotein 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections. |
| Background: | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GOLPH2 antibody, anti-golgi phosphoprotein 2 antibody, anti-GP73 antibody, anti-golgi membrane protein GP73 antibody |
| ProteinTarget: | GOLPH2 - golgi phosphoprotein 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 51280 |
| Gene_Symbol: | GOLPH2 |
| Omim_ID: | 606804, |
order or
more information: | company product webpage |
| request information: |
|