| request information: |
|
| Catalog Code: | H00051280-A01 |
| Product Name: | GOLPH2 Antibody |
| Product Description: | Mouse Polyclonal anti-GOLPH2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51280 |
| Gene Symbol: | GOLPH2 |
| Omim ID: | 606804, |
| Immunogen: | GOLPH2 (NP_057632, 302 a.a. ~ 402 a.a) partial recombinant protein with GST tag. |
| Epitope: | VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNV
EDQKRDTINLLDQREKRNHTL* |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant GOLPH2. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GP73 antibody, anti-PSEC0257 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |