| request information: |
|
| Catalog Code: | H00051231-A01 |
| Product Name: | vaccinia related kinase 3 Antibody |
| Product Description: | Mouse Polyclonal anti-vaccinia related kinase 3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51231 |
| Gene Symbol: | VRK3 |
| Immunogen: | VRK3 (NP_001020949, 322 a.a. ~ 425 a.a) partial recombinant protein with GST tag. |
| Epitope: | DLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKFVDKPGPFVGPCGHWIRPSETLQKYLKVVMALTYEEKPPYAMLR
NNLEALLQDLRVSPYDPIGLPMVP* |
| Specificity: | vaccinia related kinase 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. In both human and mouse, this gene has substitutions at several residues within the ATP binding motifs that in other kinases have been shown to be required for catalysis. In vitro assays indicate the protein lacks phosphorylation activity. The protein, however, likely retains its substrate binding capability. This gene is widely expressed in human tissues and its protein localizes to the nucleus. Alternative splicing results in multiple transcripts encoding different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |