| request information: |
|
| Catalog Code: | H00051228-A01 |
| Product Name: | GLTP Antibody |
| Product Description: | Mouse Polyclonal anti-GLTP |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51228 |
| Gene Symbol: | GLTP |
| Omim ID: | 608949, |
| Immunogen: | GLTP (NP_057517, 110 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
| Epitope: | SICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYT
ATIDVIYEMYTQMNAELNYKV* |
| Specificity: | GLTP - glycolipid transfer protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is similar to bovine and porcine proteins which accelerate transfer of certain glycosphingolipids and glyceroglycolipids between membranes. It is thought to be a cytoplasmic protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |