ExactAntigen

SS18L2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00051188-B01
Product Type:Primary Antibody
Product Name:SS18L2 Antibody
List Price:275
Clonality:Polyclonal
Gene ID:51188
Host:Mouse
Clone:synovial sarcoma translocation gene on chromosome 18-like 2
Product Description:Mouse Polyclonal anti-SS18L2 - synovial sarcoma translocation gene on chromosome 18-like 2
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame
Alternate Names:anti-KIAA-iso antibody
Immunogen:SS18L2 (AAH17804, 1 a.a. ~ 78 a.a) full-length human protein.MW of the GST tag alone is 26 KDa.
Epitope:MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYLNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME* ...
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:SS18L2
see all human SS18L2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about