ExactAntigen

LEF1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00051176-M08
Product Type:Primary Antibody
Product Name:LEF1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:51176
Host:Mouse
Clone:2E2
Isotype:IgG Mix Kappa
Product Description:Mouse Monoclonal anti-LEF1 (2E2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 bel
Alternate Names:anti-DKFZp586H0919 antibody, anti-TCF1ALPHA antibody
Immunogen:LEF1 (NP_057353, 33 a.a. ~ 138 a.a) full length recombinant protein with GST tag.
Epitope:QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:LEF1
Omim ID:153245,
see all human LEF1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about