| Catalog Code: | H00051176-M07 |
| Product Type: | Primary Antibody |
| Product Name: | LEF1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 51176 |
| Host: | Mouse |
| Clone: | 1D1 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-LEF1 (1D1) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 bel |
| Alternate Names: | anti-DKFZp586H0919 antibody, anti-TCF1ALPHA antibody |
| Immunogen: | LEF1 (NP_057353, 33 a.a. ~ 138 a.a) full length recombinant protein with GST tag. |
| Epitope: | QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | LEF1 |
| Omim ID: | 153245, |