| request information: |
|
| Catalog Code: | H00051176-M04 |
| Product Name: | LEF1 Antibody |
| Product Description: | Mouse Monoclonal anti-LEF1 (2C9) |
| Clone: | 2C9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51176 |
| Gene Symbol: | LEF1 |
| Omim ID: | 153245, |
| Immunogen: | LEF1 (NP_057353, 14 a.a. ~ 124 a.a) partial recombinant protein with GST tag. |
| Epitope: | DPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPD
DGKHPDGGLYNKGPSYSSYSGYIMMPNMNND* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp586H0919 antibody, anti-TCF1ALPHA antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |